CABS-dock: SYTNSQHQSS-YW

Project name: SYTNSQHQSS-YW

Status: done

submitted: 2026-07-23 08:46:25, status changed: 2026-07-23 12:53:03

Project settings

Protein sequence(s)	GTFLAYAQFNDTEVPLIEYSFYSDESLQYPKTVRVPYPKAGAVNPTVKFFVVNTDSLSSVTNATSIQITAPASMLIGDHYLCDVTWATQERISLQWLRRIQNYSVMDICDYDESSGRWNCLVARQHIEMSTTGWVGRFRPS input pdb
Peptide sequence	SYTNSQHQSS
Simulation mc cycles	100
Peptide secondary structure psipred	CCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	40.7695	3.1396	16.3702	128
cluster_2.pdb ( medoid)	29.0224	5.92645	25.7722	172
cluster_3.pdb ( medoid)	28.6612	7.15253	22.4771	205
cluster_4.pdb ( medoid)	15.8638	6.11454	19.0175	97
cluster_5.pdb ( medoid)	14.9856	7.54055	18.392	113
cluster_6.pdb ( medoid)	10.7254	9.04398	37.9276	97
cluster_7.pdb ( medoid)	10.2858	6.12492	13.4707	63
cluster_8.pdb ( medoid)	9.08452	6.38449	16.8121	58
cluster_9.pdb ( medoid)	5.2833	5.48899	10.7333	29
cluster_10.pdb ( medoid)	2.29548	16.5543	34.396	38