Project name: 96969fb7c31e228

Status: done

submitted: 2026-07-01 10:06:25, status changed: 2026-07-01 12:16:02

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence KRLVQVFGSNTYRLH
Simulation mc cycles50
Peptide secondary structure psipred CCCEEECCCCCEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 25.2711 5.10465 23.0384 129
cluster_2.pdb ( medoid) 19.4594 6.6292 31.4115 129
cluster_3.pdb ( medoid) 17.1822 8.32256 23.7116 143
cluster_4.pdb ( medoid) 10.8313 11.7253 28.2212 127
cluster_5.pdb ( medoid) 8.25987 12.8331 29.8415 106
cluster_6.pdb ( medoid) 6.89524 12.6174 26.0104 87
cluster_7.pdb ( medoid) 6.87982 13.6631 25.764 94
cluster_8.pdb ( medoid) 6.65686 8.11194 20.3361 54
cluster_9.pdb ( medoid) 5.34099 12.17 25.4794 65
cluster_10.pdb ( medoid) 4.78663 13.7884 23.3364 66