CABS-dock: Trail_53_to_63

Project name: Trail_53_to_63_

Status: done

submitted: 2025-12-26 17:32:42, status changed: 2025-12-26 22:10:27

Project settings

Protein sequence(s)	SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence	YSTHWNDLLFCLRC
Simulation mc cycles	100
Peptide secondary structure psipred	CCCCCCCEEEEEEC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	28.0851	3.06212	13.4696	86
cluster_2.pdb ( medoid)	20.4429	4.30466	16.3809	88
cluster_3.pdb ( medoid)	14.7413	10.2433	30.7064	151
cluster_4.pdb ( medoid)	13.8107	6.80632	20.3846	94
cluster_5.pdb ( medoid)	13.3827	5.15591	13.8839	69
cluster_6.pdb ( medoid)	12.628	5.46403	13.248	69
cluster_7.pdb ( medoid)	12.4068	12.8155	31.9793	159
cluster_8.pdb ( medoid)	6.92904	15.5866	37.6142	108
cluster_9.pdb ( medoid)	6.36127	16.5061	35.0349	105
cluster_10.pdb ( medoid)	5.32312	13.338	28.4818	71