Project name: Senormorphic

Status: done

submitted: 2026-07-08 18:34:45, status changed: 2026-07-08 21:12:33

Project settings
Protein sequence(s) LTSSERIDKQIRYILDGISALRKETCNKSNMCENLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM input pdb
Peptide sequence EARPALLTSRLRFIPK
Simulation mc cycles50
Peptide secondary structure psipred CCCCCHHHCCEEECCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 42.095 3.77717 24.5499 159
cluster_2.pdb ( medoid) 23.9584 5.84346 26.7819 140
cluster_3.pdb ( medoid) 18.4773 6.81917 33.6215 126
cluster_4.pdb ( medoid) 17.1557 4.25515 11.0327 73
cluster_5.pdb ( medoid) 14.2117 5.62917 12.6555 80
cluster_6.pdb ( medoid) 12.9977 11.7713 38.194 153
cluster_7.pdb ( medoid) 9.79372 8.2706 26.814 81
cluster_8.pdb ( medoid) 7.95756 10.556 32.8305 84
cluster_9.pdb ( medoid) 4.80583 12.6929 25.9608 61
cluster_10.pdb ( medoid) 3.63 11.8457 23.2356 43