CABS-dock: Senormorphic

Project name: Senormorphic

Status: done

submitted: 2026-07-08 18:34:45, status changed: 2026-07-08 21:12:33

Project settings

Protein sequence(s)	LTSSERIDKQIRYILDGISALRKETCNKSNMCENLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM input pdb
Peptide sequence	EARPALLTSRLRFIPK
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCHHHCCEEECCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	42.095	3.77717	24.5499	159
cluster_2.pdb ( medoid)	23.9584	5.84346	26.7819	140
cluster_3.pdb ( medoid)	18.4773	6.81917	33.6215	126
cluster_4.pdb ( medoid)	17.1557	4.25515	11.0327	73
cluster_5.pdb ( medoid)	14.2117	5.62917	12.6555	80
cluster_6.pdb ( medoid)	12.9977	11.7713	38.194	153
cluster_7.pdb ( medoid)	9.79372	8.2706	26.814	81
cluster_8.pdb ( medoid)	7.95756	10.556	32.8305	84
cluster_9.pdb ( medoid)	4.80583	12.6929	25.9608	61
cluster_10.pdb ( medoid)	3.63	11.8457	23.2356	43