CABS-dock: 9a4cdabc4f40784

Project name: 9a4cdabc4f40784

Status: done

submitted: 2026-02-18 11:42:08, status changed: 2026-02-18 15:49:24

Project settings

Protein sequence(s)	IRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVS input pdb
Peptide sequence	EYEEEEEVEEEVEEEVEEEVEEEK
Simulation mc cycles	50
Peptide secondary structure psipred	CCHHHHHHHHHHHHHHHHHHHHHC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	15.8381	6.12446	28.1877	97
cluster_2.pdb ( medoid)	15.0139	4.19611	7.94343	63
cluster_3.pdb ( medoid)	14.1604	8.05061	23.095	114
cluster_4.pdb ( medoid)	13.8035	15.2135	37.0849	210
cluster_5.pdb ( medoid)	8.46551	10.0407	20.8077	85
cluster_6.pdb ( medoid)	8.27802	14.7378	33.4067	122
cluster_7.pdb ( medoid)	6.80833	12.7785	38.2821	87
cluster_8.pdb ( medoid)	4.88582	5.52619	11.6511	27
cluster_9.pdb ( medoid)	4.10121	11.9477	23.3905	49
cluster_10.pdb ( medoid)	3.5279	13.0389	32.5029	46