Project name: 9de4f0c1bc29084

Status: done

submitted: 2026-05-01 02:48:09, status changed: 2026-05-01 08:34:32

Project settings
Protein sequence(s) NLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGL input pdb
Peptide sequence AFDAFDR
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 30.5712 4.67761 29.911 143
cluster_2.pdb ( medoid) 26.7868 8.58632 31.5896 230
cluster_3.pdb ( medoid) 23.1094 4.58687 26.0942 106
cluster_4.pdb ( medoid) 21.3762 6.26865 44.6539 134
cluster_5.pdb ( medoid) 15.7802 8.74515 26.9813 138
cluster_6.pdb ( medoid) 11.6988 4.61585 14.2117 54
cluster_7.pdb ( medoid) 11.6248 4.64526 12.3544 54
cluster_8.pdb ( medoid) 4.30971 13.226 36.0065 57
cluster_9.pdb ( medoid) 3.14572 15.8946 41.5169 50
cluster_10.pdb ( medoid) 2.96463 11.4686 37.8088 34