CABS-dock: 9e7e0a2ca18d344

Project name: 9e7e0a2ca18d344

Status: done

submitted: 2026-03-15 13:40:23, status changed: 2026-03-15 16:59:32

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	RQIKIWFQNRRMKWKKGGVQVFGSNTY
Simulation mc cycles	50
Peptide secondary structure psipred	CCEEEEEECCCCCEEECCEEEECCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	22.7016	5.15383	28.7908	117
cluster_2.pdb ( medoid)	19.7769	5.916	20.8935	117
cluster_3.pdb ( medoid)	18.2304	8.00861	32.0418	146
cluster_4.pdb ( medoid)	9.96621	13.5458	31.1217	135
cluster_5.pdb ( medoid)	9.21711	7.0521	26.4325	65
cluster_6.pdb ( medoid)	7.44898	14.0959	30.9734	105
cluster_7.pdb ( medoid)	6.41101	14.8182	30.2569	95
cluster_8.pdb ( medoid)	5.40479	12.5814	24.9434	68
cluster_9.pdb ( medoid)	5.37056	16.758	37.3528	90
cluster_10.pdb ( medoid)	4.75394	13.0418	28.934	62