CABS-dock: 9ef026077873e11

Project name: 9ef026077873e11

Status: done

submitted: 2026-03-08 14:24:22, status changed: 2026-03-08 17:10:53

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	VQLFGSNCW
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	26.2162	6.82785	22.5214	179
cluster_2.pdb ( medoid)	25.0416	3.31449	18.774	83
cluster_3.pdb ( medoid)	20.2462	7.16182	27.1782	145
cluster_4.pdb ( medoid)	16.1985	9.93918	27.9219	161
cluster_5.pdb ( medoid)	8.87953	10.2483	22.9532	91
cluster_6.pdb ( medoid)	7.41853	12.8058	26.3687	95
cluster_7.pdb ( medoid)	7.40331	8.10448	31.5557	60
cluster_8.pdb ( medoid)	6.84475	7.01268	20.1427	48
cluster_9.pdb ( medoid)	6.09195	13.2962	32.4582	81
cluster_10.pdb ( medoid)	4.99116	11.4202	19.4345	57