Project name: LVDLGGPHKSHPIPSPSFMNRHITQLRVYL_FAPdock

Status: done

submitted: 2025-10-07 22:05:11, status changed: 2025-10-08 03:22:44

Project settings
Protein sequence(s) IQLPKEEIKKLEVDEITLWYKMILPPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQITAVRKFIEMGFIDEKRIAIWGWSYGGYVSSLALASGTGLFKCGIAVAPVSSWEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTADDNVHFQNSAQIAKALVNAQVDFQAMWYSDQNHGLSGLSTNHLYTHMTHFLKQCFS input pdb
Peptide sequence LVDLGGPHKSHPIPSPSFMNRHITQLRVYL
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCCHHHHHHCEEEEEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 29.5011 7.42345 36.2444 219
cluster_2.pdb ( medoid) 29.4212 2.58317 17.8154 76
cluster_3.pdb ( medoid) 25.263 8.51048 36.9794 215
cluster_4.pdb ( medoid) 18.9103 7.77356 19.0771 147
cluster_5.pdb ( medoid) 18.1321 6.12175 34.8937 111
cluster_6.pdb ( medoid) 8.70907 10.1044 19.797 88
cluster_7.pdb ( medoid) 3.38787 11.8068 34.3785 40
cluster_8.pdb ( medoid) 3.20999 19.0031 61.0419 61
cluster_9.pdb ( medoid) 1.24039 23.3798 41.4526 29
cluster_10.pdb ( medoid) 1.0478 13.3613 31.8838 14