CABS-dock: Trail_193_to_206

Project name: Trail_193_to_206_

Status: done

submitted: 2025-12-26 17:34:28, status changed: 2025-12-26 22:02:07

Project settings

Protein sequence(s)	SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence	QEEIKENTKNDKQMV
Simulation mc cycles	100
Peptide secondary structure psipred	CHHHHHHCHHHHCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	20.2396	8.79465	26.3008	178
cluster_2.pdb ( medoid)	18.4618	6.6624	32.6856	123
cluster_3.pdb ( medoid)	13.2509	7.84855	16.9082	104
cluster_4.pdb ( medoid)	13.0643	11.1755	28.7552	146
cluster_5.pdb ( medoid)	9.50955	8.72807	25.312	83
cluster_6.pdb ( medoid)	9.0165	8.5399	22.237	77
cluster_7.pdb ( medoid)	7.83589	8.29516	24.5253	65
cluster_8.pdb ( medoid)	7.54863	7.68352	20.4101	58
cluster_9.pdb ( medoid)	7.43244	13.1854	29.147	98
cluster_10.pdb ( medoid)	4.85257	14.0132	27.8317	68