Project name: DRAMP00361M

Status: done

submitted: 2024-07-25 15:28:05, status changed: 2024-07-25 21:55:04

Project settings
Protein sequence(s) SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMVLPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQ input pdb
Peptide sequence ITCPQVTQSLAPCVPYLISG
Simulation mc cycles50
Peptide secondary structure psipred CCCCHHHHCCCCCCCCCCCC
Contact information
163:A 1:PEP 5.0 1.0
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 26.8939 6.1724 29.4526 166
cluster_2.pdb ( medoid) 24.4034 4.09779 6.98037 100
cluster_3.pdb ( medoid) 20.3775 4.95645 20.0575 101
cluster_4.pdb ( medoid) 17.1118 6.42832 19.0994 110
cluster_5.pdb ( medoid) 16.2769 0.982987 2.76833 16
cluster_6.pdb ( medoid) 13.2808 13.7793 28.1013 183
cluster_7.pdb ( medoid) 12.8935 3.87794 19.3136 50
cluster_8.pdb ( medoid) 11.815 13.3728 31.4222 158
cluster_9.pdb ( medoid) 10.7946 4.44668 16.5069 48
cluster_10.pdb ( medoid) 5.92396 11.4788 26.8316 68