CABS-dock: a27d23a7e3c667e

Project name: a27d23a7e3c667e

Status: done

submitted: 2025-08-25 18:38:35, status changed: 2025-08-25 20:10:51

Project settings

Protein sequence(s)	VVQVNDSMYGFIGTDVVLHCSFANKITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTVMAK input pdb
Peptide sequence	QRTVAVYSLRIAGFHG
Simulation mc cycles	50
Peptide secondary structure psipred	CCEEEEEEEEECCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	35.2056	2.92567	15.7768	103
cluster_2.pdb ( medoid)	25.367	7.25352	21.9932	184
cluster_3.pdb ( medoid)	19.3142	8.0252	25.6743	155
cluster_4.pdb ( medoid)	15.9961	8.18952	22.6631	131
cluster_5.pdb ( medoid)	15.0672	7.89794	26.0359	119
cluster_6.pdb ( medoid)	13.4863	6.59928	20.5132	89
cluster_7.pdb ( medoid)	9.21195	5.97051	12.5097	55
cluster_8.pdb ( medoid)	8.57598	6.99628	17.224	60
cluster_9.pdb ( medoid)	6.86176	7.8697	23.6939	54
cluster_10.pdb ( medoid)	4.16945	11.992	28.0025	50