CABS-dock: a2eb80e92ed7d5a

Project name: a2eb80e92ed7d5a

Status: done

submitted: 2025-12-27 10:21:03, status changed: 2025-12-27 17:01:24

Project settings

Protein sequence(s)	RSVASSSKLWMLLEFSAFLEQQQDPDTYNKHLFVHIGLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNGSSFYGVSSQYEESSPENNMIITTCSTKVCSFGKQVVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSSVLENFTILQVVTTNRDTQETLLCIAYVVFEVSASEHGAQHHIYRLVKEDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPP input pdb
Peptide sequence	GLFDIIKKIAESF
Simulation mc cycles	50
Peptide secondary structure psipred	CHHHHHHHHHHHC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	24.6392	8.36067	47.0033	206
cluster_2.pdb ( medoid)	19.5099	7.07335	36.3058	138
cluster_3.pdb ( medoid)	18.8488	6.4195	35.578	121
cluster_4.pdb ( medoid)	12.3133	3.57337	17.5785	44
cluster_5.pdb ( medoid)	12.0948	10.087	29.207	122
cluster_6.pdb ( medoid)	9.62069	10.0824	26.4386	97
cluster_7.pdb ( medoid)	8.67617	12.5631	37.417	109
cluster_8.pdb ( medoid)	5.78727	11.9227	30.6025	69
cluster_9.pdb ( medoid)	3.75725	15.703	36.5805	59
cluster_10.pdb ( medoid)	2.55336	13.7074	31.936	35