CABS-dock: a3aea2b26f834a1

Project name: a3aea2b26f834a1

Status: done

submitted: 2026-03-19 13:43:32, status changed: 2026-03-19 17:52:27

Project settings

Protein sequence(s)	NVKYNFMRIIKYEFILNDALNQSIIRANAQYLTAAALHNLDEAVKFDMGAYKSSAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILE input pdb
Peptide sequence	DHLSDNYTLDHDRAIH
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	26.8454	4.13478	22.8004	111
cluster_2.pdb ( medoid)	20.6347	4.6039	18.1264	95
cluster_3.pdb ( medoid)	17.9075	7.92965	26.6342	142
cluster_4.pdb ( medoid)	16.1622	7.91971	22.5497	128
cluster_5.pdb ( medoid)	14.9545	7.89062	21.7263	118
cluster_6.pdb ( medoid)	12.6529	6.87589	23.4174	87
cluster_7.pdb ( medoid)	8.66794	15.4593	38.2258	134
cluster_8.pdb ( medoid)	5.81935	11.857	24.0321	69
cluster_9.pdb ( medoid)	4.30509	15.3307	30.3911	66
cluster_10.pdb ( medoid)	2.82218	17.7168	35.4406	50