CABS-dock: HMVRMFRQWVFV

Project name: HMVRMFRQWVFV

Status: done

submitted: 2026-04-02 10:03:12, status changed: 2026-04-02 10:32:31

Project settings

Protein sequence(s)	MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVKLPA input pdb
Peptide sequence	HMVRMFRQWVFV
Simulation mc cycles	5
Peptide secondary structure psipred	CCCCCCCEEECC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	45.0745	1.84139	11.4164	83
cluster_2.pdb ( medoid)	39.339	3.02499	14.5308	119
cluster_3.pdb ( medoid)	18.2903	5.63139	22.4274	103
cluster_4.pdb ( medoid)	17.494	6.05922	27.5711	106
cluster_5.pdb ( medoid)	15.0237	14.2441	35.6676	214
cluster_6.pdb ( medoid)	13.8795	10.8794	44.9779	151
cluster_7.pdb ( medoid)	11.8374	5.40661	23.0063	64
cluster_8.pdb ( medoid)	5.40418	19.0593	41.5093	103
cluster_9.pdb ( medoid)	2.58974	14.6733	41.4498	38
cluster_10.pdb ( medoid)	1.58754	11.9682	32.2515	19