Project name: SVHRSP_TACR3

Status: done

submitted: 2026-04-14 09:16:14, status changed: 2026-04-14 16:20:53

Project settings
Protein sequence(s) NQFVQPSWRIALWSLAYGVVVAVAVLGNLIVIWIILAHKRMRTVTNYFLVNLAFSDASMAAFNTLVNFIYALHSEWYFGANYCRFQNFFPITAVFASIYSMTAIAVDRYMAIIDPLKPRLSATATKIVIGSIWILAFLLAFPQCLYSKTKVMPGRTLCFVQWPEGPKQHFTYHIIVIILVYCFPLLIMGITYTIVGITLWGEQLKAKRKVVKMMIIVVMTFAICWLPYHIYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLNKRFRAGFKR input pdb
Peptide sequence KVLNGPEEEAAAPAE
Simulation mc cycles50
Peptide secondary structure psipred CCCCCHHHHHCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 47.0886 1.80511 8.50076 85
cluster_2.pdb ( medoid) 37.7124 3.89792 15.5812 147
cluster_3.pdb ( medoid) 15.8932 6.73245 21.7581 107
cluster_4.pdb ( medoid) 15.096 8.34659 22.0664 126
cluster_5.pdb ( medoid) 14.9928 9.5379 29.5088 143
cluster_6.pdb ( medoid) 9.94813 7.5391 14.685 75
cluster_7.pdb ( medoid) 8.80979 8.85378 30.1121 78
cluster_8.pdb ( medoid) 6.71673 15.0371 48.9698 101
cluster_9.pdb ( medoid) 5.84684 13.8536 29.985 81
cluster_10.pdb ( medoid) 5.31253 10.7293 25.1897 57