CABS-dock: acacd99b9881aaa

Project name: acacd99b9881aaa

Status: done

submitted: 2026-01-16 10:37:36, status changed: 2026-01-16 13:57:47

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	RVIVQFVGSNCR
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEEECCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	15.345	5.53925	29.6863	85
cluster_2.pdb ( medoid)	13.985	10.6543	41.8996	149
cluster_3.pdb ( medoid)	11.6523	12.1006	37.0019	141
cluster_4.pdb ( medoid)	9.59191	11.9893	48.4168	115
cluster_5.pdb ( medoid)	9.57957	5.84578	20.3069	56
cluster_6.pdb ( medoid)	7.20391	9.85576	22.9146	71
cluster_7.pdb ( medoid)	6.7451	9.78488	29.7369	66
cluster_8.pdb ( medoid)	6.51707	20.5614	78.3999	134
cluster_9.pdb ( medoid)	6.26915	19.1414	57.9224	120
cluster_10.pdb ( medoid)	4.87035	12.9354	31.0642	63