Project name: ad995d5db6ee335

Status: done

submitted: 2026-07-09 04:57:18, status changed: 2026-07-09 08:57:27

Project settings
Protein sequence(s) GSHMMLEADLELERAADVRRWEEQAEISSGSSSPPILSSISIKNEEEEQTLGLLEDGAYRIKQKGILGYSQIGAGVYYKEGTFHTMWHVTRRRGAVLMHKGKRIEPSWADVKKDLISYGGGGWKLEGEWKEGEEVQVLLALEPGKNPRAVQTKPGLFKTNTGTIGAVSLDFSPGTSGSPIVDKKGKVVGLYGNGVVVVTRSGAYYVSAIAN input pdb
Peptide sequence YLNFACNGLR
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 30.0645 5.65452 16.0238 170
cluster_2.pdb ( medoid) 26.7351 4.18926 27.008 112
cluster_3.pdb ( medoid) 25.2822 2.53142 13.519 64
cluster_4.pdb ( medoid) 20.1236 7.30487 16.0833 147
cluster_5.pdb ( medoid) 14.437 3.80965 16.428 55
cluster_6.pdb ( medoid) 14.1098 12.9697 35.6674 183
cluster_7.pdb ( medoid) 11.7495 8.34081 30.4965 98
cluster_8.pdb ( medoid) 5.95822 11.4128 30.181 68
cluster_9.pdb ( medoid) 4.79497 13.1388 30.5893 63
cluster_10.pdb ( medoid) 2.09254 19.1156 41.8456 40