CABS-dock: ad995d5db6ee335

Project name: ad995d5db6ee335

Status: done

submitted: 2026-07-09 04:57:18, status changed: 2026-07-09 08:57:27

Project settings

Protein sequence(s)	GSHMMLEADLELERAADVRRWEEQAEISSGSSSPPILSSISIKNEEEEQTLGLLEDGAYRIKQKGILGYSQIGAGVYYKEGTFHTMWHVTRRRGAVLMHKGKRIEPSWADVKKDLISYGGGGWKLEGEWKEGEEVQVLLALEPGKNPRAVQTKPGLFKTNTGTIGAVSLDFSPGTSGSPIVDKKGKVVGLYGNGVVVVTRSGAYYVSAIAN input pdb
Peptide sequence	YLNFACNGLR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	30.0645	5.65452	16.0238	170
cluster_2.pdb ( medoid)	26.7351	4.18926	27.008	112
cluster_3.pdb ( medoid)	25.2822	2.53142	13.519	64
cluster_4.pdb ( medoid)	20.1236	7.30487	16.0833	147
cluster_5.pdb ( medoid)	14.437	3.80965	16.428	55
cluster_6.pdb ( medoid)	14.1098	12.9697	35.6674	183
cluster_7.pdb ( medoid)	11.7495	8.34081	30.4965	98
cluster_8.pdb ( medoid)	5.95822	11.4128	30.181	68
cluster_9.pdb ( medoid)	4.79497	13.1388	30.5893	63
cluster_10.pdb ( medoid)	2.09254	19.1156	41.8456	40