CABS-dock: aee843f81955db1

Project name: aee843f81955db1

Status: done

submitted: 2025-12-30 15:29:42, status changed: 2025-12-30 18:18:24

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	RVIVQCGSNSFR
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEECCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	23.185	7.20294	24.566	167
cluster_2.pdb ( medoid)	20.96	6.15457	20.6351	129
cluster_3.pdb ( medoid)	17.6971	5.87668	29.3347	104
cluster_4.pdb ( medoid)	15.7637	9.70581	26.0319	153
cluster_5.pdb ( medoid)	7.88776	13.185	27.1714	104
cluster_6.pdb ( medoid)	5.78448	13.4844	27.8554	78
cluster_7.pdb ( medoid)	5.49924	12.1835	27.8623	67
cluster_8.pdb ( medoid)	5.2769	13.0759	28.5733	69
cluster_9.pdb ( medoid)	5.25769	10.6511	22.0932	56
cluster_10.pdb ( medoid)	5.13123	14.2266	36.9933	73