CABS-dock: RD CABS 1EB9 BLINDING

Project name: RD CABS 1EB9 BLINDING

Status: done

submitted: 2026-07-08 16:01:44, status changed: 2026-07-08 17:53:39

Project settings

Protein sequence(s)	FLGEEDIPREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVNSSGRIVTNKQTSV input pdb
Peptide sequence	KQTSV
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	23.7515	5.0523	26.0239	120
cluster_2.pdb ( medoid)	23.054	1.82181	9.38194	42
cluster_3.pdb ( medoid)	21.8968	6.62198	29.6473	145
cluster_4.pdb ( medoid)	17.9471	4.84759	21.4943	87
cluster_5.pdb ( medoid)	17.8969	8.49309	41.5601	152
cluster_6.pdb ( medoid)	16.6517	9.72875	34.2796	162
cluster_7.pdb ( medoid)	7.42212	13.3385	32.9429	99
cluster_8.pdb ( medoid)	4.56871	13.5706	33.4647	62
cluster_9.pdb ( medoid)	3.5198	14.2054	35.732	50
cluster_10.pdb ( medoid)	3.27457	15.2692	37.338	50