Project name: RD CABS 1EB9 BLINDING

Status: done

submitted: 2026-07-08 16:01:44, status changed: 2026-07-08 17:53:39

Project settings
Protein sequence(s) FLGEEDIPREPRRIVIHRGSTGLGFNIIGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEANSRVNSSGRIVTNKQTSV input pdb
Peptide sequence KQTSV
Simulation mc cycles50
Peptide secondary structure psipred CCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 23.7515 5.0523 26.0239 120
cluster_2.pdb ( medoid) 23.054 1.82181 9.38194 42
cluster_3.pdb ( medoid) 21.8968 6.62198 29.6473 145
cluster_4.pdb ( medoid) 17.9471 4.84759 21.4943 87
cluster_5.pdb ( medoid) 17.8969 8.49309 41.5601 152
cluster_6.pdb ( medoid) 16.6517 9.72875 34.2796 162
cluster_7.pdb ( medoid) 7.42212 13.3385 32.9429 99
cluster_8.pdb ( medoid) 4.56871 13.5706 33.4647 62
cluster_9.pdb ( medoid) 3.5198 14.2054 35.732 50
cluster_10.pdb ( medoid) 3.27457 15.2692 37.338 50