CABS-dock: b32c81bea559f9d

Project name: b32c81bea559f9d

Status: done

submitted: 2026-06-17 09:08:37, status changed: 2026-06-17 18:57:29

Project settings

Protein sequence(s)	DVQLVESGGGVVQPGGSLRLSCVASGYVHKINFYGWYRQAPGKEREKVAHISIGDQTDYASAKGRFTISRDESKNTVYLQMNSLRPEDTAAYYCRALSRIWPYDYWGQGTLVTVSSDVQLVESGGGVVQPGGSLRLSCVASGYVHKINFYGWYRQAPGKEREKVAHISIGDQTDYADSAKGRFTISRDESKNTVYLQMNSLRPEDTAAYYCRALSRIWPYDYWGQGTLVTVSSDVQLVESGGGVVQPGGSLRLSCVASGYVHKINFYGWYRQAPGKEREKVAHISIQTDYAAKGRFTISRDESKNTVYLQMNSLRPEDTAAYYCRALSRIWPYDYWGQGTLVTVSS input pdb
Peptide sequence	IPSGSPFNR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	43.8649	4.01232	33.281	176
cluster_2.pdb ( medoid)	29.5599	5.7172	31.0668	169
cluster_3.pdb ( medoid)	24.4579	7.23693	37.8253	177
cluster_4.pdb ( medoid)	20.5825	3.49812	10.6276	72
cluster_5.pdb ( medoid)	14.9624	7.01757	37.1048	105
cluster_6.pdb ( medoid)	11.4401	4.72023	10.7645	54
cluster_7.pdb ( medoid)	10.2243	7.92228	35.3061	81
cluster_8.pdb ( medoid)	4.58332	13.5273	34.8881	62
cluster_9.pdb ( medoid)	4.52811	11.263	38.0686	51
cluster_10.pdb ( medoid)	3.71302	14.2741	42.6921	53