Project name: b32c81bea559f9d

Status: done

submitted: 2026-06-17 09:08:37, status changed: 2026-06-17 18:57:29

Project settings
Protein sequence(s) DVQLVESGGGVVQPGGSLRLSCVASGYVHKINFYGWYRQAPGKEREKVAHISIGDQTDYASAKGRFTISRDESKNTVYLQMNSLRPEDTAAYYCRALSRIWPYDYWGQGTLVTVSSDVQLVESGGGVVQPGGSLRLSCVASGYVHKINFYGWYRQAPGKEREKVAHISIGDQTDYADSAKGRFTISRDESKNTVYLQMNSLRPEDTAAYYCRALSRIWPYDYWGQGTLVTVSSDVQLVESGGGVVQPGGSLRLSCVASGYVHKINFYGWYRQAPGKEREKVAHISIQTDYAAKGRFTISRDESKNTVYLQMNSLRPEDTAAYYCRALSRIWPYDYWGQGTLVTVSS input pdb
Peptide sequence IPSGSPFNR
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 43.8649 4.01232 33.281 176
cluster_2.pdb ( medoid) 29.5599 5.7172 31.0668 169
cluster_3.pdb ( medoid) 24.4579 7.23693 37.8253 177
cluster_4.pdb ( medoid) 20.5825 3.49812 10.6276 72
cluster_5.pdb ( medoid) 14.9624 7.01757 37.1048 105
cluster_6.pdb ( medoid) 11.4401 4.72023 10.7645 54
cluster_7.pdb ( medoid) 10.2243 7.92228 35.3061 81
cluster_8.pdb ( medoid) 4.58332 13.5273 34.8881 62
cluster_9.pdb ( medoid) 4.52811 11.263 38.0686 51
cluster_10.pdb ( medoid) 3.71302 14.2741 42.6921 53