CABS-dock: CLT1 w CLIC1

Project name: CLT1 w CLIC1

Status: done

submitted: 2026-07-08 11:24:25, status changed: 2026-07-08 23:22:17

Project settings

Protein sequence(s)	PQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGELPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEGVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGELPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEGVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK input pdb
Peptide sequence	CGLIIQKNEC
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEEECCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	33.2953	4.71538	27.1214	157
cluster_2.pdb ( medoid)	29.8599	6.73143	17.058	201
cluster_3.pdb ( medoid)	19.3293	5.69086	33.899	110
cluster_4.pdb ( medoid)	12.4901	8.88704	31.7581	111
cluster_5.pdb ( medoid)	11.9007	12.8564	42.0888	153
cluster_6.pdb ( medoid)	11.1899	6.70248	12.5202	75
cluster_7.pdb ( medoid)	6.61393	9.22296	31.6144	61
cluster_8.pdb ( medoid)	3.92106	17.8523	39.8133	70
cluster_9.pdb ( medoid)	1.32469	21.892	49.5439	29
cluster_10.pdb ( medoid)	1.00624	20.8698	37.3769	21