Project name: CLT1 w CLIC1

Status: done

submitted: 2026-07-08 11:24:25, status changed: 2026-07-08 23:22:17

Project settings
Protein sequence(s) PQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGELPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEGVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGELPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEGVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK input pdb
Peptide sequence CGLIIQKNEC
Simulation mc cycles50
Peptide secondary structure psipred CCCEEECCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 33.2953 4.71538 27.1214 157
cluster_2.pdb ( medoid) 29.8599 6.73143 17.058 201
cluster_3.pdb ( medoid) 19.3293 5.69086 33.899 110
cluster_4.pdb ( medoid) 12.4901 8.88704 31.7581 111
cluster_5.pdb ( medoid) 11.9007 12.8564 42.0888 153
cluster_6.pdb ( medoid) 11.1899 6.70248 12.5202 75
cluster_7.pdb ( medoid) 6.61393 9.22296 31.6144 61
cluster_8.pdb ( medoid) 3.92106 17.8523 39.8133 70
cluster_9.pdb ( medoid) 1.32469 21.892 49.5439 29
cluster_10.pdb ( medoid) 1.00624 20.8698 37.3769 21