CABS-dock: b866b578bed798d

Project name: b866b578bed798d

Status: done

submitted: 2026-02-27 13:12:06, status changed: 2026-02-27 20:01:54

Project settings

Protein sequence(s)	MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL input pdb
Peptide sequence	FESLQPSDTDLGAKVPK
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	36.5406	3.36611	22.2902	123
cluster_2.pdb ( medoid)	23.4856	5.91853	27.7631	139
cluster_3.pdb ( medoid)	17.2763	7.7563	37.2301	134
cluster_4.pdb ( medoid)	15.799	6.4561	19.6847	102
cluster_5.pdb ( medoid)	12.9161	12.0779	33.1546	156
cluster_6.pdb ( medoid)	11.1393	10.9522	25.5407	122
cluster_7.pdb ( medoid)	6.47641	9.10999	36.8959	59
cluster_8.pdb ( medoid)	5.75864	13.8922	33.262	80
cluster_9.pdb ( medoid)	5.67768	9.86317	23.7114	56
cluster_10.pdb ( medoid)	2.55729	11.3401	24.7511	29