CABS-dock: b8751265e39a941

Project name: b8751265e39a941

Status: done

submitted: 2026-02-18 08:05:55, status changed: 2026-02-18 22:44:12

Project settings

Protein sequence(s)	DIEADHVGTYGISVYQSPGDIGQYTFEFDGDELFYVDLDKKETVWMLPEFGQLASFDPQGGLQNIAVVKHNLGVLTKRSNSTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVADGVYETSFFVNRDYSFHKLSYLTFIPSDDDIYDCKVEHWGLEEPVLKHWSSADLPVSKMRMATPLLMQASERHFVYQFMGECYFTNGTQRIRYVTRYIYNREEYVRYDSDVGEHRAVTELGRPDAEYWNSQPEILERTRAELDTVCRHNYEGPETHTSLRRLEQPNVVISLSHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWSSAE input pdb
Peptide sequence	DTGSTGVGTAAGVTPSAT
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	38.6706	2.66352	26.4596	103
cluster_2.pdb ( medoid)	33.8206	3.28202	18.1697	111
cluster_3.pdb ( medoid)	26.1303	3.98006	38.0965	104
cluster_4.pdb ( medoid)	15.546	8.87685	46.4492	138
cluster_5.pdb ( medoid)	12.2292	9.89436	54.2671	121
cluster_6.pdb ( medoid)	11.5996	6.03469	11.0623	70
cluster_7.pdb ( medoid)	8.47298	10.2679	25.4282	87
cluster_8.pdb ( medoid)	4.45575	16.1589	39.133	72
cluster_9.pdb ( medoid)	3.2289	18.2725	39.0082	59
cluster_10.pdb ( medoid)	2.59124	20.0676	44.3683	52