CABS-dock: b95513863a5f367

Project name: b95513863a5f367

Status: done

submitted: 2026-06-23 17:04:34, status changed: 2026-06-23 22:32:28

Project settings

Protein sequence(s)	VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence	HRHRHVQLFGYRHRHRH
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	20.9097	7.17371	32.2996	150
cluster_2.pdb ( medoid)	18.0619	12.4572	28.9185	225
cluster_3.pdb ( medoid)	15.2341	7.54887	27.2518	115
cluster_4.pdb ( medoid)	12.2218	9.32758	24.1049	114
cluster_5.pdb ( medoid)	7.83463	13.7849	25.4552	108
cluster_6.pdb ( medoid)	6.28444	13.8437	33.0555	87
cluster_7.pdb ( medoid)	5.26372	11.9687	31.7026	63
cluster_8.pdb ( medoid)	3.88965	12.0833	24.8134	47
cluster_9.pdb ( medoid)	3.76267	15.9461	30.7764	60
cluster_10.pdb ( medoid)	2.50462	12.3771	20.2355	31