Project name: b95513863a5f367

Status: done

submitted: 2026-06-23 17:04:34, status changed: 2026-06-23 22:32:28

Project settings
Protein sequence(s) VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence HRHRHVQLFGYRHRHRH
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 20.9097 7.17371 32.2996 150
cluster_2.pdb ( medoid) 18.0619 12.4572 28.9185 225
cluster_3.pdb ( medoid) 15.2341 7.54887 27.2518 115
cluster_4.pdb ( medoid) 12.2218 9.32758 24.1049 114
cluster_5.pdb ( medoid) 7.83463 13.7849 25.4552 108
cluster_6.pdb ( medoid) 6.28444 13.8437 33.0555 87
cluster_7.pdb ( medoid) 5.26372 11.9687 31.7026 63
cluster_8.pdb ( medoid) 3.88965 12.0833 24.8134 47
cluster_9.pdb ( medoid) 3.76267 15.9461 30.7764 60
cluster_10.pdb ( medoid) 2.50462 12.3771 20.2355 31