CABS-dock: bb5bbcf31c80290

Project name: bb5bbcf31c80290

Status: done

submitted: 2026-07-27 01:52:12, status changed: 2026-07-27 12:45:20

Project settings

Protein sequence(s)	AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM input pdb
Peptide sequence	QRFCTGHFGGLYPCNG
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCEECCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	21.5782	5.14408	20.0107	111
cluster_2.pdb ( medoid)	19.1051	5.75763	28.3889	110
cluster_3.pdb ( medoid)	18.8917	8.99866	29.3003	170
cluster_4.pdb ( medoid)	17.6049	5.56664	31.2857	98
cluster_5.pdb ( medoid)	17.0558	4.28007	40.4185	73
cluster_6.pdb ( medoid)	14.5646	11.2602	45.3554	164
cluster_7.pdb ( medoid)	9.49603	11.1626	36.007	106
cluster_8.pdb ( medoid)	6.49282	5.54459	33.8221	36
cluster_9.pdb ( medoid)	5.46031	14.6512	38.3802	80
cluster_10.pdb ( medoid)	3.26532	15.9249	29.8463	52