Project name: bb5bbcf31c80290

Status: done

submitted: 2026-07-27 01:52:12, status changed: 2026-07-27 12:45:20

Project settings
Protein sequence(s) AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM input pdb
Peptide sequence QRFCTGHFGGLYPCNG
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCEECCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 21.5782 5.14408 20.0107 111
cluster_2.pdb ( medoid) 19.1051 5.75763 28.3889 110
cluster_3.pdb ( medoid) 18.8917 8.99866 29.3003 170
cluster_4.pdb ( medoid) 17.6049 5.56664 31.2857 98
cluster_5.pdb ( medoid) 17.0558 4.28007 40.4185 73
cluster_6.pdb ( medoid) 14.5646 11.2602 45.3554 164
cluster_7.pdb ( medoid) 9.49603 11.1626 36.007 106
cluster_8.pdb ( medoid) 6.49282 5.54459 33.8221 36
cluster_9.pdb ( medoid) 5.46031 14.6512 38.3802 80
cluster_10.pdb ( medoid) 3.26532 15.9249 29.8463 52