CABS-dock: bb86a4bcb8c0957

Project name: bb86a4bcb8c0957

Status: done

submitted: 2026-06-23 08:49:11, status changed: 2026-06-23 11:19:08

Project settings

Protein sequence(s)	MVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGATMVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGAT input pdb
Peptide sequence	VQLFGYHHHHHHHHHHH
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	29.228	4.20829	20.3265	123
cluster_2.pdb ( medoid)	21.5788	5.70005	23.6026	123
cluster_3.pdb ( medoid)	19.7794	8.64535	27.6685	171
cluster_4.pdb ( medoid)	15.8207	8.28027	30.0621	131
cluster_5.pdb ( medoid)	14.6312	6.83472	25.4753	100
cluster_6.pdb ( medoid)	13.1075	8.01067	29.25	105
cluster_7.pdb ( medoid)	12.4202	10.3058	31.2022	128
cluster_8.pdb ( medoid)	7.41391	8.90219	17.6075	66
cluster_9.pdb ( medoid)	4.23531	8.97219	15.7232	38
cluster_10.pdb ( medoid)	1.75268	8.5583	23.8547	15