Project name: bb86a4bcb8c0957

Status: done

submitted: 2026-06-23 08:49:11, status changed: 2026-06-23 11:19:08

Project settings
Protein sequence(s) MVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGATMVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGAT input pdb
Peptide sequence VQLFGYHHHHHHHHHHH
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 29.228 4.20829 20.3265 123
cluster_2.pdb ( medoid) 21.5788 5.70005 23.6026 123
cluster_3.pdb ( medoid) 19.7794 8.64535 27.6685 171
cluster_4.pdb ( medoid) 15.8207 8.28027 30.0621 131
cluster_5.pdb ( medoid) 14.6312 6.83472 25.4753 100
cluster_6.pdb ( medoid) 13.1075 8.01067 29.25 105
cluster_7.pdb ( medoid) 12.4202 10.3058 31.2022 128
cluster_8.pdb ( medoid) 7.41391 8.90219 17.6075 66
cluster_9.pdb ( medoid) 4.23531 8.97219 15.7232 38
cluster_10.pdb ( medoid) 1.75268 8.5583 23.8547 15