CABS-dock: be3476d267aefcd

Project name: be3476d267aefcd

Status: done

submitted: 2026-01-10 15:03:27, status changed: 2026-01-10 18:04:03

Project settings

Protein sequence(s)	MVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGATMVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGAT input pdb
Peptide sequence	LPPTDESIKYTIYNSTGIQIGAYNYMEIGG
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCEEEECCCCEEECCCCEECCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	22.748	4.74767	21.3463	108
cluster_2.pdb ( medoid)	15.8637	8.06871	24.8546	128
cluster_3.pdb ( medoid)	12.071	6.21326	23.6641	75
cluster_4.pdb ( medoid)	11.2829	11.5219	27.6004	130
cluster_5.pdb ( medoid)	10.634	15.3282	29.0474	163
cluster_6.pdb ( medoid)	6.80263	13.6712	31.2569	93
cluster_7.pdb ( medoid)	6.42832	15.7117	31.0299	101
cluster_8.pdb ( medoid)	6.3761	14.4289	30.357	92
cluster_9.pdb ( medoid)	6.19158	7.91398	20.1413	49
cluster_10.pdb ( medoid)	4.62879	13.1784	27.5636	61