CABS-dock: 2BCK_CEEASV_E2

Project name: 2BCK_CEEASV_E2_A:TYR2

Status: done

submitted: 2026-07-09 10:52:10, status changed: 2026-07-10 07:30:00

Project settings

Protein sequence(s)

GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPGSGGGLNDIF input pdb

Peptide sequence

CEEASVTVVEGQVDYYGLYYVHEGIR

Simulation mc cycles

200

Peptide secondary structure psipred

CCCCEEEEEEEEEEEEEEEEEECCCC

Contact information

A:TYR2

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	33.2068	2.80063	24.0618	93
cluster_2.pdb ( medoid)	31.5498	4.02538	25.7122	127
cluster_3.pdb ( medoid)	22.8296	3.24141	16.5728	74
cluster_4.pdb ( medoid)	17.1553	8.33562	36.415	143
cluster_5.pdb ( medoid)	16.7682	8.11059	22.6975	136
cluster_6.pdb ( medoid)	8.86667	12.6316	33.1089	112
cluster_7.pdb ( medoid)	6.53222	19.5952	49.9996	128
cluster_8.pdb ( medoid)	5.08983	13.5565	34.4552	69
cluster_9.pdb ( medoid)	3.28768	26.7666	67.2428	88
cluster_10.pdb ( medoid)	3.17169	9.45867	25.3991	30