Project name: 2BCK_CEEASV_E2_A:TYR2

Status: done

submitted: 2026-07-09 10:52:10, status changed: 2026-07-10 07:30:00

Project settings
Protein sequence(s) GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPGSGGGLNDIF input pdb
Peptide sequence CEEASVTVVEGQVDYYGLYYVHEGIR
Simulation mc cycles200
Peptide secondary structure psipred CCCCEEEEEEEEEEEEEEEEEECCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 33.2068 2.80063 24.0618 93
cluster_2.pdb ( medoid) 31.5498 4.02538 25.7122 127
cluster_3.pdb ( medoid) 22.8296 3.24141 16.5728 74
cluster_4.pdb ( medoid) 17.1553 8.33562 36.415 143
cluster_5.pdb ( medoid) 16.7682 8.11059 22.6975 136
cluster_6.pdb ( medoid) 8.86667 12.6316 33.1089 112
cluster_7.pdb ( medoid) 6.53222 19.5952 49.9996 128
cluster_8.pdb ( medoid) 5.08983 13.5565 34.4552 69
cluster_9.pdb ( medoid) 3.28768 26.7666 67.2428 88
cluster_10.pdb ( medoid) 3.17169 9.45867 25.3991 30