CABS-dock: c649171c5416ef2

Project name: c649171c5416ef2

Status: done

submitted: 2026-06-17 06:27:27, status changed: 2026-06-17 11:20:10

Project settings

Protein sequence(s)	EDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITG input pdb
Peptide sequence	GRDQGSAYSNRTALFP
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	24.7232	4.57061	37.8326	113
cluster_2.pdb ( medoid)	11.8008	11.1009	46.9158	131
cluster_3.pdb ( medoid)	9.25336	12.6441	41.6417	117
cluster_4.pdb ( medoid)	7.8106	10.3705	26.0901	81
cluster_5.pdb ( medoid)	7.41166	12.2779	25.4468	91
cluster_6.pdb ( medoid)	7.17716	12.6791	30.4894	91
cluster_7.pdb ( medoid)	4.93666	12.9642	28.0933	64
cluster_8.pdb ( medoid)	4.34782	12.88	25.9035	56
cluster_9.pdb ( medoid)	3.28198	13.4065	28.3723	44
cluster_10.pdb ( medoid)	1.15329	20.81	40.6479	24