Project name: c649171c5416ef2

Status: done

submitted: 2026-06-17 06:27:27, status changed: 2026-06-17 11:20:10

Project settings
Protein sequence(s) EDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITG input pdb
Peptide sequence GRDQGSAYSNRTALFP
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 24.7232 4.57061 37.8326 113
cluster_2.pdb ( medoid) 11.8008 11.1009 46.9158 131
cluster_3.pdb ( medoid) 9.25336 12.6441 41.6417 117
cluster_4.pdb ( medoid) 7.8106 10.3705 26.0901 81
cluster_5.pdb ( medoid) 7.41166 12.2779 25.4468 91
cluster_6.pdb ( medoid) 7.17716 12.6791 30.4894 91
cluster_7.pdb ( medoid) 4.93666 12.9642 28.0933 64
cluster_8.pdb ( medoid) 4.34782 12.88 25.9035 56
cluster_9.pdb ( medoid) 3.28198 13.4065 28.3723 44
cluster_10.pdb ( medoid) 1.15329 20.81 40.6479 24