CABS-dock: EVP

Project name: EVP_PEPH002

Status: done

submitted: 2026-07-21 19:34:33, status changed: 2026-07-21 22:45:12

Project settings

Protein sequence(s)	GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLEVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS input pdb
Peptide sequence	SLAFVFVL
Simulation mc cycles	50
Peptide secondary structure psipred	CCEEEEEC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	37.6091	4.49359	23.5418	169
cluster_2.pdb ( medoid)	22.884	4.67576	19.9004	107
cluster_3.pdb ( medoid)	21.2847	5.26198	27.5296	112
cluster_4.pdb ( medoid)	20.3984	7.84374	22.7107	160
cluster_5.pdb ( medoid)	11.9326	9.46987	26.2029	113
cluster_6.pdb ( medoid)	8.0993	4.81523	18.3885	39
cluster_7.pdb ( medoid)	7.34327	11.7114	39.6967	86
cluster_8.pdb ( medoid)	7.05768	15.3025	39.0507	108
cluster_9.pdb ( medoid)	4.58461	13.5235	29.8964	62
cluster_10.pdb ( medoid)	3.36843	13.0625	28.7682	44