Project name: EVP_PEPH002

Status: done

submitted: 2026-07-21 19:34:33, status changed: 2026-07-21 22:45:12

Project settings
Protein sequence(s) GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLEVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS input pdb
Peptide sequence SLAFVFVL
Simulation mc cycles50
Peptide secondary structure psipred CCEEEEEC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 37.6091 4.49359 23.5418 169
cluster_2.pdb ( medoid) 22.884 4.67576 19.9004 107
cluster_3.pdb ( medoid) 21.2847 5.26198 27.5296 112
cluster_4.pdb ( medoid) 20.3984 7.84374 22.7107 160
cluster_5.pdb ( medoid) 11.9326 9.46987 26.2029 113
cluster_6.pdb ( medoid) 8.0993 4.81523 18.3885 39
cluster_7.pdb ( medoid) 7.34327 11.7114 39.6967 86
cluster_8.pdb ( medoid) 7.05768 15.3025 39.0507 108
cluster_9.pdb ( medoid) 4.58461 13.5235 29.8964 62
cluster_10.pdb ( medoid) 3.36843 13.0625 28.7682 44