Project name: c710e9cbd99a051

Status: done

submitted: 2026-07-28 09:49:14, status changed: 2026-07-28 11:39:19

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence VQVFGDNNW
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 19.3338 8.22395 29.2293 159
cluster_2.pdb ( medoid) 18.4502 7.2628 28.7368 134
cluster_3.pdb ( medoid) 14.0113 10.1347 23.998 142
cluster_4.pdb ( medoid) 11.1285 8.62648 36.0862 96
cluster_5.pdb ( medoid) 6.20857 15.1404 44.9653 94
cluster_6.pdb ( medoid) 6.11129 12.9269 35.2745 79
cluster_7.pdb ( medoid) 5.88068 12.7536 34.757 75
cluster_8.pdb ( medoid) 5.73286 11.3381 49.9284 65
cluster_9.pdb ( medoid) 5.46226 15.3782 39.2455 84
cluster_10.pdb ( medoid) 5.31661 13.5425 29.7943 72