CABS-dock: c710e9cbd99a051

Project name: c710e9cbd99a051

Status: done

submitted: 2026-07-28 09:49:14, status changed: 2026-07-28 11:39:19

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	VQVFGDNNW
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	19.3338	8.22395	29.2293	159
cluster_2.pdb ( medoid)	18.4502	7.2628	28.7368	134
cluster_3.pdb ( medoid)	14.0113	10.1347	23.998	142
cluster_4.pdb ( medoid)	11.1285	8.62648	36.0862	96
cluster_5.pdb ( medoid)	6.20857	15.1404	44.9653	94
cluster_6.pdb ( medoid)	6.11129	12.9269	35.2745	79
cluster_7.pdb ( medoid)	5.88068	12.7536	34.757	75
cluster_8.pdb ( medoid)	5.73286	11.3381	49.9284	65
cluster_9.pdb ( medoid)	5.46226	15.3782	39.2455	84
cluster_10.pdb ( medoid)	5.31661	13.5425	29.7943	72