CABS-dock: HGRLRGSLAQGV

Project name: HGRLRGSLAQGV

Status: done

submitted: 2026-04-02 10:04:03, status changed: 2026-04-02 10:32:43

Project settings

Protein sequence(s)	MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKGSMVYFKVGNETRKYKMTSIRDVKPTDVGVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVKLPA input pdb
Peptide sequence	HGRLRGSLAQGV
Simulation mc cycles	5
Peptide secondary structure psipred	CCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	68.6926	1.47032	14.3839	101
cluster_2.pdb ( medoid)	24.7791	4.15673	20.7315	103
cluster_3.pdb ( medoid)	17.5147	8.62134	38.3503	151
cluster_4.pdb ( medoid)	15.0886	6.76008	32.1919	102
cluster_5.pdb ( medoid)	12.9792	7.93579	23.1086	103
cluster_6.pdb ( medoid)	10.1448	13.9973	29.691	142
cluster_7.pdb ( medoid)	8.54013	12.5291	26.8772	107
cluster_8.pdb ( medoid)	6.09522	14.1094	31.6607	86
cluster_9.pdb ( medoid)	2.85804	19.5939	39.2513	56
cluster_10.pdb ( medoid)	2.66776	12.7448	27.1528	34