Project name: primed p20

Status: done

submitted: 2025-05-09 14:45:35, status changed: 2025-05-09 19:47:40

Project settings
Protein sequence(s) TPIATFVSGSPSLNTYNATTVNSSANAFSCAYYLQQWNIQGLLVTSLYLKLDSATMGNRPGDLNSANAKWFTFWVSAYLQQCNPSGIQAGTVSPSTATLTDFEPMANRSVTSPWTYSANGYYEPSIGEFQVFSPVVTGAWNPGNIGIRVLPVPVSASGERYTLLCYSLQCTNASIFNPNNSGTMIVGPVLYSCPAASLP input pdb
Peptide sequence MQKRWK
Simulation mc cycles50
Peptide secondary structure psipred CCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 30.7255 4.32865 21.8648 133
cluster_2.pdb ( medoid) 24.2701 5.60359 32.8665 136
cluster_3.pdb ( medoid) 23.4831 4.13064 26.5462 97
cluster_4.pdb ( medoid) 19.9015 11.4062 38.4479 227
cluster_5.pdb ( medoid) 14.4515 4.98219 19.1857 72
cluster_6.pdb ( medoid) 12.9584 7.94851 36.2998 103
cluster_7.pdb ( medoid) 11.455 8.9044 22.9203 102
cluster_8.pdb ( medoid) 6.13147 8.80703 20.7487 54
cluster_9.pdb ( medoid) 4.05966 8.37509 27.5003 34
cluster_10.pdb ( medoid) 3.32531 12.6304 32.1072 42