CABS-dock: cca404a6ad22b34

Project name: cca404a6ad22b34

Status: done

submitted: 2026-03-13 11:32:29, status changed: 2026-03-13 14:42:27

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	RRRWKKVQLFGSNDA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCEEEEECCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	18.6066	7.95416	33.3387	148
cluster_2.pdb ( medoid)	16.4879	9.40081	30.2289	155
cluster_3.pdb ( medoid)	12.8733	11.3413	42.0578	146
cluster_4.pdb ( medoid)	12.2884	7.48671	27.7041	92
cluster_5.pdb ( medoid)	11.211	10.5254	34.859	118
cluster_6.pdb ( medoid)	10.1203	13.4383	31.0627	136
cluster_7.pdb ( medoid)	5.66062	12.3661	29.3968	70
cluster_8.pdb ( medoid)	4.46453	16.7991	35.5172	75
cluster_9.pdb ( medoid)	2.33867	15.3934	26.9002	36
cluster_10.pdb ( medoid)	1.50603	15.9359	26.2927	24