CABS-dock: cde8229cfbce7c6

Project name: cde8229cfbce7c6

Status: done

submitted: 2026-07-08 09:37:16, status changed: 2026-07-08 13:23:04

Project settings

Protein sequence(s)	GSHMMLEADLELERAADVRRWEEQAEISSGSSSPPILSSISIKNEEEEQTLGLLEDGAYRIKQKGILGYSQIGAGVYYKEGTFHTMWHVTRRRGAVLMHKGKRIEPSWADVKKDLISYGGGGWKLEGEWKEGEEVQVLLALEPGKNPRAVQTKPGLFKTNTGTIGAVSLDFSPGTSGSPIVDKKGKVVGLYGNGVVVVTRSGAYYVSAIAN input pdb
Peptide sequence	FRGHSNFGVFQPGR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	28.2511	3.85826	27.8335	109
cluster_2.pdb ( medoid)	25.4971	4.54953	24.3557	116
cluster_3.pdb ( medoid)	22.0391	6.30697	22.5507	139
cluster_4.pdb ( medoid)	14.0026	7.71287	24.2797	108
cluster_5.pdb ( medoid)	9.81154	13.1478	30.9556	129
cluster_6.pdb ( medoid)	8.98252	15.1405	37.5706	136
cluster_7.pdb ( medoid)	6.71455	9.23367	23.7033	62
cluster_8.pdb ( medoid)	5.60034	16.9632	39.5674	95
cluster_9.pdb ( medoid)	3.67113	17.4333	36.467	64
cluster_10.pdb ( medoid)	3.25978	12.8843	32.0397	42