Project name: cde8229cfbce7c6

Status: done

submitted: 2026-07-08 09:37:16, status changed: 2026-07-08 13:23:04

Project settings
Protein sequence(s) GSHMMLEADLELERAADVRRWEEQAEISSGSSSPPILSSISIKNEEEEQTLGLLEDGAYRIKQKGILGYSQIGAGVYYKEGTFHTMWHVTRRRGAVLMHKGKRIEPSWADVKKDLISYGGGGWKLEGEWKEGEEVQVLLALEPGKNPRAVQTKPGLFKTNTGTIGAVSLDFSPGTSGSPIVDKKGKVVGLYGNGVVVVTRSGAYYVSAIAN input pdb
Peptide sequence FRGHSNFGVFQPGR
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 28.2511 3.85826 27.8335 109
cluster_2.pdb ( medoid) 25.4971 4.54953 24.3557 116
cluster_3.pdb ( medoid) 22.0391 6.30697 22.5507 139
cluster_4.pdb ( medoid) 14.0026 7.71287 24.2797 108
cluster_5.pdb ( medoid) 9.81154 13.1478 30.9556 129
cluster_6.pdb ( medoid) 8.98252 15.1405 37.5706 136
cluster_7.pdb ( medoid) 6.71455 9.23367 23.7033 62
cluster_8.pdb ( medoid) 5.60034 16.9632 39.5674 95
cluster_9.pdb ( medoid) 3.67113 17.4333 36.467 64
cluster_10.pdb ( medoid) 3.25978 12.8843 32.0397 42