Project name: ced3361bee8f984

Status: done

submitted: 2026-07-01 10:14:50, status changed: 2026-07-01 13:13:09

Project settings
Protein sequence(s) LATDKDKLSYSIGADLGKNFKNQGIDVNPEAMAKGMQDAMSGAQLALTEQQMKDVLNKFQKDLMAKRTAEFNKKADENKVKGEAFLTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLIDGTVFDSTEKTGKPATFQVSQVIPGWTEALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISVKK input pdb
Peptide sequence DGYFLV
Simulation mc cycles50
Peptide secondary structure psipred CCCEEC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 34.7042 4.2358 23.2774 147
cluster_2.pdb ( medoid) 31.3525 7.17646 26.6441 225
cluster_3.pdb ( medoid) 29.4637 4.81949 27.3391 142
cluster_4.pdb ( medoid) 29.3712 6.06037 28.3787 178
cluster_5.pdb ( medoid) 20.9767 6.00667 36.093 126
cluster_6.pdb ( medoid) 5.57396 8.79088 22.3343 49
cluster_7.pdb ( medoid) 4.38255 8.89892 24.8527 39
cluster_8.pdb ( medoid) 3.20039 10.6237 23.8035 34
cluster_9.pdb ( medoid) 1.88002 18.0849 40.3716 34
cluster_10.pdb ( medoid) 1.52935 17.0007 35.7618 26